PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do005920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 218aa    MW: 22802.9 Da    PI: 10.4395
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do005920.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.45.7e-3777134360
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 e+ l+cprC s++tkfCy+nny+++qPr+fC+aC+ryWt+GGa+rnvPvG+grrkn+ 
  Do005920.1  77 EARLPCPRCRSRDTKFCYFNNYNVNQPRHFCRACHRYWTAGGAIRNVPVGSGRRKNRP 134
                 56789**************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-3079133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.46380134IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2581133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MLPHVDMPPS RAAAACTGAA GIKLFGKVIT TQQQQPVHKA GAAGNAPPPR LLQQAASGRG  60
SADLLEEAAR ARAAAAEARL PCPRCRSRDT KFCYFNNYNV NQPRHFCRAC HRYWTAGGAI  120
RNVPVGSGRR KNRPVLPPSA PHAATATNTD HVSGSVSPPP VFTTGLAVPA YHGSPFHLAP  180
SSSPAYTAAA GLPETTMGQC WWLVAGGAAH AVAPDRAF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270061e-124KJ727006.1 Zea mays clone pUT3982 C2C2-DOF transcription factor (DOF44) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963664.21e-77PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotO229671e-35CDF4_ARATH; Cyclic dof factor 4
TrEMBLC5Z0X35e-62C5Z0X3_SORBI; Putative uncharacterized protein Sb09g025450
STRINGSb09g025450.11e-61(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.15e-33Dof family protein